C22-107-07 rHuGMF-β說明書

Catalog Number: C22-107-07
Source:  Escherichia coli.
Molecular Weight:  Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
Quantity:  2μg/10μg/1000μg
AA Sequence:  SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPER
 QPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT
 EDLTEEWLREKLGFFH
Purity:  >98% by SDS-PAGE and HPLC analyses.
Biological Activity:  Data Not Available.
Physical Appearance:  Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:  Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Endotoxin:  Less than 1EU/μg of rHuGMF-β as determined by LAL method.
Reconstitution:  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the
 bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a
 concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and
 stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage:  This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage,
 preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For
 maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to
 -70°C. Avoid repeated freeze/thaw cycles.
Usage:  This material is offered by Shanghai Corning Bio-Tech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Human Glia Maturation Factor beta
Glia Maturation Factor beta (GMF-β), a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family.
GMF-β appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the
progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-
inflammatory cytokines.